| Protein: 58585118 NP_001011589.1 odorant binding protein 4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.1* | 53.2 | 41.7 | 0.12230216 | 1.2757794 |
| Scape | 9.7* | 46.7 | 43.6 | 0.22247706 | 1.071101 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 31.5 | 19.2 | 49.3 | 0.6389452 | 0.38945234 |
| Leg, middle | 34.9 | 16.1* | 49 | 0.71224487 | 0.32857144 |
| Leg, rear | 23 | 20.1 | 56.9 | 0.40421793 | 0.3532513 |
| Mandibular gland | 15.5 | 84.5 | 0.18343195 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 14.7 | 85.3 | 0.17233294 | ||
| Heart | 5.7 | 94.3 | 0.060445387 | ||
| Hypopharyngeal gland | |||||
| Galea | 13.9* | 20.5 | 65.5 | 0.21221374 | 0.3129771 |
| Glossa | 33 | 22.2 | 44.8 | 0.73660713 | 0.4955357 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.1 | 26.6 | 61.5 | 0.3105691 | 0.43252033 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKITIVSLLCVIYCALVHADTVAILCSQKAGFDLSDLKSMYESNSEEQMKKLGCFEACVF QKLHFMDGNTLNVEKLESGTRELTPDDFTEDVHEIIEQCVSKAADEDECMVARKYIDCAL EKMKFLDDELEKIAGN |
 Top
| |