| Protein: 328780312 XP_624401.3 PREDICTED: alcohol dehydrogenase [NADP+] A-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.3 | 23.4 | 42.3 | 0.8108747 | 0.5531915 |
| Scape | 23.7 | 38.6 | 37.8 | 0.6269841 | 1.0211641 |
| Brain | 72.3* | 27.7 | 2.6101084 | ||
| Crop | 23.4 | 38 | 38.5 | 0.6077922 | 0.987013 |
| Eye | |||||
| Intestine | 25.6 | 49 | 25.3 | 1.0118577 | 1.9367589 |
| Leg, front | 26 | 50.4 | 23.7 | 1.0970464 | 2.1265824 |
| Leg, middle | 26.9 | 44.8 | 28.3 | 0.95053005 | 1.5830389 |
| Leg, rear | 24.7 | 44.7 | 30.6 | 0.8071895 | 1.4607843 |
| Mandibular gland | 8.2 | 79.3 | 12.4 | 0.66129035 | 6.395161 |
| Rectum | 48.7 | 51.3 | 0.94931775 | ||
| Salivary gland, cerebral | 59.1 | 24.2 | 16.6 | 3.560241 | 1.4578314 |
| Salivary gland, thoracic | 39.8 | 24.1 | 36.1 | 1.102493 | 0.66759 |
| Sternite | 21.2 | 65.2 | 13.6 | 1.5588236 | 4.7941175 |
| Tergite | 6 | 74.6 | 19.4 | 0.30927834 | 3.8453608 |
| Ventriculus | 47.9 | 52.1 | 0.9193858 | ||
| Thoracic muscle | |||||
| Fat body | 31.1 | 38.7 | 30.2 | 1.0298014 | 1.281457 |
| Malpighian tubules | 56.8* | 27.7 | 15.5 | 3.6645162 | 1.7870967 |
| Nerve chord | 12.4 | 77.7* | 9.8 | 1.2653061 | 7.928571 |
| Poison sac | |||||
| Sting | 56.9 | 43.1 | 1.3201857 | ||
| Heart | 13.4 | 57.3 | 29.4 | 0.45578232 | 1.9489796 |
| Hypopharyngeal gland | 83.1 | 16.9 | 4.9171596 | ||
| Galea | 12.5 | 59.8 | 27.7 | 0.45126355 | 2.1588447 |
| Glossa | 13.6* | 11.8* | 74.6 | 0.18230563 | 0.15817694 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.7 | 49.5 | 30.6 | 0.872549 | 1.617647 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHKKEQVVPACKTSLKNFGFDYVDLYLIHWPMSYDEVNEKESFWPKTKDLYENVDYCDTW QGMEECVKLGLTKSIGLSNFNSQQIDRILSIAQIKPVMNQVECHPNLNQKKLRDFCKQRD IVITAYSPLGSPKRTWAKPTDPQVAIEAPEILEISKKYEKTPAQVVLRYLIDIGTVPIPK SSSKERIKQNIDIFDFKLLPQEIATIDKLDCGLRICPAKECANHKDYPFSIEF |
 Top
| |