| Protein: 328789667 XP_001119981.2 PREDICTED: cytochrome P450 9e2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 16.8* | 83.2 | 0.20192307 | ||
| Scape | 40.9 | 10.6* | 48.5 | 0.843299 | 0.2185567 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 19.2 | 50.7 | 30.2 | 0.6357616 | 1.678808 |
| Leg, front | |||||
| Leg, middle | 40.1 | 59.9 | 0.6694491 | ||
| Leg, rear | 57.2 | 10.7 | 32.1 | 1.7819315 | 0.33333334 |
| Mandibular gland | |||||
| Rectum | 8.5 | 91.5 | 0.09289618 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 59.7 | 6.6 | 33.7 | 1.7715133 | 0.1958457 |
| Sternite | 20.7 | 3.4* | 75.9 | 0.27272728 | 0.044795785 |
| Tergite | 9.5 | 11.7* | 78.8 | 0.12055837 | 0.14847715 |
| Ventriculus | 21.3 | 78.7 | 0.27064803 | ||
| Thoracic muscle | |||||
| Fat body | 2.7* | 9.8* | 87.5 | 0.030857144 | 0.112 |
| Malpighian tubules | 36.9 | 18.8 | 44.4 | 0.8310811 | 0.4234234 |
| Nerve chord | 7* | 66.8 | 26.2 | 0.26717559 | 2.5496182 |
| Poison sac | |||||
| Sting | |||||
| Heart | 4* | 20.6* | 75.5 | 0.052980132 | 0.27284768 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.2 | 19.9 | 60.4 | 0.43377483 | 0.3294702 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASAFLTLVTGALLLLCFYLYLKYTYWKRNGIPYSKGYYPIIGHFLPLIMKKQSYSEIIE EIYRDSNHSMVGMYKGMKPVLILRDINLIKTVLQSNFSKFHENAVKIDPKLDPLLAKNPF FCYGELWQTGRKRLTYAFSNARLKILFAAVYEVCTKFRNFLDRRLESSKKYEVELKSLFL KFTSEVVANAGLGIEGFCFEDDKVQSMFTNLDNNDFLDTFLIGIIVHFPFLTKLLRIQFL PTKHDKFFRTVVKKNLELRKSDPIPRNDFIQLMIEMEQTGEKIDEEIVAAHAVSFYLDGV ETSSVTLNFIGCQLAIHQDVQEKLRKEVRSTLEKHGGVLTFEALKDMTYMNQVISESQRY FSALGFLGKICTDEFELQGSDGLNYRAKPGTELLIPICGLHKDPKYWDNPEIFDPERFSD ENKQRIEKMAFIPFGEGPRICVGMRMAMLQMKSCLATLMKDYKLEVSPKMQLPLKLSPTY FLSAPLGGGWVLISKA |
 Top
| |