| Protein: 217416454 NP_001136128.1 glutathione S-transferase S4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.2 | 51.8 | 0.93050194 | ||
| Scape | |||||
| Brain | 87.2* | 12.8 | 6.8125 | ||
| Crop | 42.2 | 57.8 | 0.7301038 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 24.4* | 75.6 | 0.3227513 | ||
| Leg, middle | |||||
| Leg, rear | 72.9 | 0.2* | 26.9 | 2.7100372 | 0.007434944 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 9.3* | 90.7 | 0.10253583 | ||
| Sternite | |||||
| Tergite | 0.8* | 99.2 | 0.008064516 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 1.8* | 9.3* | 88.8 | 0.02027027 | 0.10472973 |
| Malpighian tubules | 26.8 | 41.9 | 31.3 | 0.85623 | 1.3386581 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 3.8 | 65.2 | 30.9 | 0.12297735 | 2.1100323 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.6 | 40.8 | 56.6 | 0.45229682 | 0.7208481 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASYKLVYFNVMGLGEPIRFLLSYGGVEFEDVRITHSSEDWSNMKPTTPFGQLPTLEING KVYSQTLPICRYLAKQFNLLGKTDLDTLQIDAIASALYDFRWLTISSYYRESDPVLKAKK KVDVMTRVIPFYLNKLEELAKNNGGYLHGDKLSYADLFFVGISDSLNTAYESDITNDKPY LKSLKQKILAIPNIKAWVEKRPKLEF |
 Top
| |