| Protein: 66548261 XP_624343.1 PREDICTED: succinyl-CoA ligase [ADP-forming] subunit beta mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.9 | 28.1 | 40.1 | 0.79551125 | 0.70074815 |
| Scape | 26.9 | 33 | 40.1 | 0.6708229 | 0.8229426 |
| Brain | 46.2 | 24.7 | 29 | 1.5931034 | 0.85172415 |
| Crop | 18.6 | 37.6 | 43.8 | 0.42465752 | 0.8584475 |
| Eye | |||||
| Intestine | 12.4 | 32.6 | 55 | 0.22545454 | 0.59272724 |
| Leg, front | 36.6 | 24.6 | 38.8 | 0.943299 | 0.6340206 |
| Leg, middle | 34.2 | 26.4 | 39.3 | 0.870229 | 0.67175573 |
| Leg, rear | 25 | 30.1 | 44.9 | 0.55679286 | 0.6703786 |
| Mandibular gland | 67.1 | 32.9 | 2.0395136 | ||
| Rectum | 47.1 | 38.6 | 14.4 | 3.2708333 | 2.6805556 |
| Salivary gland, cerebral | 24.9 | 10.9 | 64.1 | 0.38845554 | 0.1700468 |
| Salivary gland, thoracic | 37.1 | 30.2 | 32.7 | 1.1345565 | 0.9235474 |
| Sternite | 79.6 | 20.4 | 3.9019608 | ||
| Tergite | 48.6 | 30.1 | 21.3 | 2.2816901 | 1.4131455 |
| Ventriculus | 31.8 | 30.8 | 37.4 | 0.85026735 | 0.8235294 |
| Thoracic muscle | 7.1 | 48.4 | 44.5 | 0.15955056 | 1.0876404 |
| Fat body | 43.1 | 37 | 19.9 | 2.1658292 | 1.8592964 |
| Malpighian tubules | 50.9* | 30.1 | 18.9 | 2.6931217 | 1.5925926 |
| Nerve chord | 14.6 | 47.8 | 37.6 | 0.3882979 | 1.2712766 |
| Poison sac | |||||
| Sting | 42.6 | 57.4 | 0.74216026 | ||
| Heart | 43.3 | 22 | 34.7 | 1.2478386 | 0.6340058 |
| Hypopharyngeal gland | 91.1 | 8.9 | 10.235955 | ||
| Galea | 39 | 61 | 0.6393443 | ||
| Glossa | 50 | 26.3 | 23.7 | 2.1097047 | 1.1097046 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 36.6 | 35.9 | 0.97214484 | 1.0194986 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATMLSRTISLVENLTRFNGSKILGCKINLVKQVRNLNVHEHISYSLLNEAGVPTPKFGV AKTPDEAAKLAADLKSKDIVLKAQVLAGGRGKGHFKGTNISGVKMCETPEEAKKLASQML GKLLITKQTGEAGRICNAVMVTQRMFPRKEYYLAVMMERAFGGPVIIASSQGGVNIEEVA ATNPSAIMYEPIDIYKGITKDQAERIAIKLGLQNVKDYISNIIVNLYQMFLKKDALLLEV NPLAEDVNGQYFALDCKCRFDDNAEFRQKELFSLRDWTQEDTKEVEAAKYDLNYIALDGN IGCMVNGAGLAMATMDIIKLHGGEPANFLDVGGGASTSAVKEAFKIITSDSRVHALLVNI FGGIMRCDVIAEGIIAATKELSLKIPVVVRLQGTNVDEAKALIANAGLKIVPIDDLDEAA RVAVKLSTIVKLAQSENLSVNFEIPSIS |
 Top
| |