| Protein: 48098241 XP_392023.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.2 | 52.8 | 0.8939394 | ||
| Scape | 44.6 | 18 | 37.3 | 1.1957104 | 0.48257372 |
| Brain | |||||
| Crop | |||||
| Eye | 37.6 | 62.4 | 0.6025641 | ||
| Intestine | 33.8 | 27.5 | 38.8 | 0.87113404 | 0.7087629 |
| Leg, front | 27.6 | 38 | 34.5 | 0.8 | 1.1014493 |
| Leg, middle | 35.1 | 38.9 | 26 | 1.35 | 1.4961538 |
| Leg, rear | 11.1 | 24 | 64.9 | 0.17103235 | 0.3697997 |
| Mandibular gland | 32.4 | 67.6 | 0.47928995 | ||
| Rectum | |||||
| Salivary gland, cerebral | 13.3 | 47.1 | 39.6 | 0.33585858 | 1.189394 |
| Salivary gland, thoracic | 29.2 | 42.3 | 28.5 | 1.0245614 | 1.4842105 |
| Sternite | 30.2 | 18.7 | 51 | 0.5921569 | 0.36666667 |
| Tergite | 51.4 | 48.6 | 1.0576131 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 39.9 | 36.6 | 23.6 | 1.690678 | 1.5508474 |
| Malpighian tubules | 42.9 | 24.4 | 32.8 | 1.3079268 | 0.74390244 |
| Nerve chord | 20.3 | 48 | 31.6 | 0.6424051 | 1.5189873 |
| Poison sac | |||||
| Sting | 29.8 | 70.2 | 0.42450142 | ||
| Heart | 37.9 | 32.7 | 29.4 | 1.2891157 | 1.1122448 |
| Hypopharyngeal gland | 88.5 | 11.5 | 7.695652 | ||
| Galea | 57.6 | 42.4 | 1.3584906 | ||
| Glossa | 48.9 | 33.5 | 17.5 | 2.7942858 | 1.9142857 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 36.6 | 40.6 | 0.8743842 | 0.9014778 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVVLSRLLFVRNQKISHKNGLLNKLIEKNNNNYTFQNQGALRWMSEHRTMEITPSRWQWH KTKDWMHFYFFVGAIPAGLIIFFTNVFIGPAHLEPIPDGYIPKQWEYHSHPISRFLSKYF FPNEQMEYEKLLHKLSVANNKRLLFQLEKQIRDLERQHHDYKYWSYREGTASQIIKLRKK LDEAI |
 Top
| |