| Protein: 66513815 XP_396838.2 PREDICTED: vesicle-trafficking protein SEC22b-B-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.4 | 49.6 | 1.016129 | ||
| Scape | 27.5 | 72.5 | 0.37931034 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 59.7 | 40.3 | 1.4813895 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 33.9 | 66.1 | 0.5128593 | ||
| Rectum | |||||
| Salivary gland, cerebral | 83.2 | 16.8 | 4.952381 | ||
| Salivary gland, thoracic | 35.1 | 35.1 | 29.7 | 1.1818181 | 1.1818181 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 68.4 | 31.6 | 2.164557 | ||
| Thoracic muscle | |||||
| Fat body | 30.7 | 39 | 30.3 | 1.0132014 | 1.2871287 |
| Malpighian tubules | 46.4 | 53.6 | 0.86567163 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 20.5 | 46.9 | 32.7 | 0.62691134 | 1.4342507 |
| Hypopharyngeal gland | 17.2 | 82.8 | 0.20772947 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.9 | 42 | 46 | 0.9326087 | 0.9130435 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVLLTMIARIIDGLPLAATMQEDEQTGRSILEYQNQAKMLFRRLGPQSPTRCTIETGPYL FHYLIENDVCYLVLCEKNYSKRIAYSYLEDIAQEFHSLYGRRVNSVTRPYSFIEFNTYIQ KAKKVFLDGRSRRNMNALNSQLQDVQRIMVQNIDDVLQRGTVLSELDTKTQNLSMLSQKY KKDATYLNSKSMYVKAVAGLVAFLVFLLYFFIL |
 Top
| |