| Protein: 66531704 XP_393085.2 PREDICTED: f-actin-capping protein subunit beta-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.2 | 41.9 | 27.9 | 1.0824373 | 1.5017921 |
| Scape | 37.6 | 29.9 | 32.5 | 1.156923 | 0.92 |
| Brain | 35.3 | 64.7 | 0.54559505 | ||
| Crop | 72.3* | 27.7 | 2.6101084 | ||
| Eye | |||||
| Intestine | 39.3 | 60.7 | 0.64744645 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 27.4 | 35.3 | 37.3 | 0.73458445 | 0.9463807 |
| Salivary gland, thoracic | 47 | 13.6 | 39.4 | 1.1928934 | 0.34517765 |
| Sternite | 46 | 54 | 0.8518519 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 32 | 68 | 0.47058824 | ||
| Fat body | 35.3 | 49.8 | 14.9 | 2.3691275 | 3.3422818 |
| Malpighian tubules | 29.4 | 33.9 | 36.8 | 0.79891306 | 0.9211956 |
| Nerve chord | 52.9 | 27.2 | 19.9 | 2.6582913 | 1.3668342 |
| Poison sac | |||||
| Sting | |||||
| Heart | 35.5 | 35.5 | 29.1 | 1.2199312 | 1.2199312 |
| Hypopharyngeal gland | 41.4 | 58.6 | 0.7064846 | ||
| Galea | 68.6 | 31.4 | 2.1847134 | ||
| Glossa | 56 | 44 | 1.2727273 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39 | 40.3 | 40.4 | 0.9653465 | 0.99752474 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTEQQMDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDKESGKDYL LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIDANHAFDQYRELYFEGGVSSVY LWDLDHGFAAVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRIAHYKLTSTAMLWLQTN KHGSGTMNLGGSLTRQVEQDAQISENSPHIANIGRMVEDMENKIRNTLNEIYFGKTKDIV NGLRSVQSLADQRQQAALRQDLAAALQRRNANN |
 Top
| |