| Protein: 48138568 XP_393411.1 PREDICTED: ubiquitin-conjugating enzyme E2 variant 2-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.2 | 30.9 | 30.8 | 1.2402598 | 1.0032468 |
| Scape | 33.5 | 27.1 | 39.4 | 0.8502538 | 0.6878173 |
| Brain | 46.9 | 24.1 | 29 | 1.6172414 | 0.8310345 |
| Crop | 31.2 | 68.8 | 0.45348838 | ||
| Eye | |||||
| Intestine | 45.6 | 54.4 | 0.8382353 | ||
| Leg, front | 32.9 | 39.9 | 27.3 | 1.2051282 | 1.4615384 |
| Leg, middle | 25 | 47.6 | 27.3 | 0.9157509 | 1.7435898 |
| Leg, rear | 32.3 | 35.8 | 31.9 | 1.0125391 | 1.122257 |
| Mandibular gland | 10.6 | 89.4 | 0.11856823 | ||
| Rectum | 25.5 | 74.5 | 0.34228188 | ||
| Salivary gland, cerebral | 55 | 5.5 | 39.5 | 1.392405 | 0.1392405 |
| Salivary gland, thoracic | 43.2 | 21.5 | 35.3 | 1.223796 | 0.6090652 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 30.6 | 35.2 | 34.3 | 0.8921283 | 1.026239 |
| Nerve chord | 28.9 | 39.2 | 31.9 | 0.9059561 | 1.2288401 |
| Poison sac | |||||
| Sting | 64.3 | 35.7 | 1.8011204 | ||
| Heart | 33.9 | 33.9 | 32.2 | 1.052795 | 1.052795 |
| Hypopharyngeal gland | 65.6 | 34.4 | 1.9069767 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.1 | 35.2 | 42.1 | 0.8337292 | 0.8361045 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAVPTTGVVVPRNFRLLEELEQGQKGVGDGTISWGLENDDDMTLTHWTGMIIGPPRTPYE NRMYSLKIDCGQRYPDDAPNVRFLSRINMNCINSTTGAVDNRSVPVLAKWQREYTIKTVL QELRRLMTLKENMKLSQPPEGSTF |
 Top
| |