| Protein: 110758517 XP_001120056.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 60.2 | 39.8 | 1.5125629 | ||
| Scape | 40.1 | 29.7 | 30.2 | 1.3278146 | 0.98344374 |
| Brain | |||||
| Crop | |||||
| Eye | 66.9 | 9.6 | 23.4 | 2.8589745 | 0.41025642 |
| Intestine | 50 | 50 | 1 | ||
| Leg, front | 26.6 | 35.9 | 37.5 | 0.70933336 | 0.9573333 |
| Leg, middle | 64 | 36 | 1.7777778 | ||
| Leg, rear | 10.2 | 49.4 | 40.4 | 0.25247526 | 1.2227722 |
| Mandibular gland | 69.2 | 30.8 | 2.2467532 | ||
| Rectum | |||||
| Salivary gland, cerebral | 15.9 | 35.1 | 49 | 0.3244898 | 0.71632653 |
| Salivary gland, thoracic | 36.8 | 35.2 | 28 | 1.3142858 | 1.2571429 |
| Sternite | 31.3 | 36.6 | 32.1 | 0.97507787 | 1.1401869 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 4.6 | 90.5 | 4.9 | 0.93877554 | 18.469387 |
| Fat body | 16.7 | 71.4* | 11.9 | 1.4033613 | 6 |
| Malpighian tubules | 41.6 | 22.7 | 35.7 | 1.1652662 | 0.63585436 |
| Nerve chord | 50.3 | 12.7 | 37 | 1.3594594 | 0.34324324 |
| Poison sac | |||||
| Sting | 11.7 | 88.3 | 0.13250282 | ||
| Heart | 57.7 | 13.4 | 28.9 | 1.9965398 | 0.4636678 |
| Hypopharyngeal gland | 90.2 | 9.8 | 9.204082 | ||
| Galea | 31.1 | 41.5 | 27.4 | 1.1350365 | 1.5145985 |
| Glossa | 62.8 | 9 | 28.2 | 2.2269504 | 0.31914893 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.4 | 37.9 | 33.5 | 1.2059702 | 1.1313432 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPGIEHRSQTPFIQWLRDFGRGRKHVSSLRHADGIAARTQPPPHVPGGPYHKSSKVYYYT RDARRLVQPPIEIYTEGHLEAGKIDTTKIKLEALSKPQ |
 Top
| |