| Protein: 295842193 NP_001170961.1 cytochrome c |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.1 | 40.5 | 27.4 | 1.1715329 | 1.4781022 |
| Scape | 26.3 | 29.9 | 43.9 | 0.59908885 | 0.6810934 |
| Brain | 24.2 | 39.4 | 36.4 | 0.66483516 | 1.0824176 |
| Crop | 48.5 | 22.2 | 29.3 | 1.6552901 | 0.75767916 |
| Eye | 29.3 | 36.5 | 34.1 | 0.85923755 | 1.0703813 |
| Intestine | 37.4 | 25.4 | 37.2 | 1.0053763 | 0.6827957 |
| Leg, front | 31.6 | 35.3 | 33 | 0.95757574 | 1.069697 |
| Leg, middle | 31.2 | 33.8 | 35 | 0.8914286 | 0.9657143 |
| Leg, rear | 25.2 | 35.9 | 38.9 | 0.6478149 | 0.92287916 |
| Mandibular gland | 16.7 | 43 | 40.3 | 0.41439205 | 1.0669975 |
| Rectum | 31 | 15.9 | 53.1 | 0.58380413 | 0.29943502 |
| Salivary gland, cerebral | 31.2 | 28 | 40.8 | 0.7647059 | 0.6862745 |
| Salivary gland, thoracic | 39.7 | 28.4 | 31.9 | 1.2445141 | 0.89028215 |
| Sternite | 36.7 | 39.3 | 24 | 1.5291667 | 1.6375 |
| Tergite | 51.1 | 24.5 | 24.3 | 2.1028807 | 1.0082304 |
| Ventriculus | 22.3 | 34.4 | 43.3 | 0.51501155 | 0.79445726 |
| Thoracic muscle | 33.7 | 66.3 | 0.50829566 | ||
| Fat body | 45.2 | 40.6 | 14.2 | 3.1830986 | 2.859155 |
| Malpighian tubules | 62.9* | 21.8 | 15.2 | 4.138158 | 1.4342105 |
| Nerve chord | 29.2 | 34.5 | 36.3 | 0.8044077 | 0.9504132 |
| Poison sac | |||||
| Sting | 37 | 63 | 0.5873016 | ||
| Heart | 47 | 20.8 | 32.2 | 1.4596273 | 0.6459627 |
| Hypopharyngeal gland | 90.2 | 9.8 | 9.204082 | ||
| Galea | 28.9 | 50.6 | 20.5 | 1.4097561 | 2.4682927 |
| Glossa | 36.9 | 38.1 | 25 | 1.476 | 1.524 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.7 | 35.3 | 34.2 | 1.0146198 | 1.0321637 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGIPAGDPEKGKKIFVQKCAQCHTIESGGKHKVGPNLYGVYGRKTGQAPGYSYTDANKGK GITWNKETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYIEQASK |
 Top
| |