| Protein: 66553147 XP_624346.1 PREDICTED: v-type proton ATPase subunit G |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.9 | 31.1 | 33 | 1.0878788 | 0.94242424 |
| Scape | 31.5 | 28 | 40.5 | 0.7777778 | 0.69135803 |
| Brain | 34.8 | 36.5 | 28.7 | 1.2125436 | 1.271777 |
| Crop | 53.3 | 21.7 | 25 | 2.132 | 0.868 |
| Eye | 39.2 | 60.8 | 0.6447368 | ||
| Intestine | 33.3 | 22.6 | 44.1 | 0.75510204 | 0.5124717 |
| Leg, front | 32.4 | 24.3 | 43.3 | 0.7482679 | 0.5612009 |
| Leg, middle | 23.5 | 39.2 | 37.3 | 0.6300268 | 1.0509384 |
| Leg, rear | 30.8 | 41.3 | 27.9 | 1.1039426 | 1.4802867 |
| Mandibular gland | 4 | 72.3 | 23.7 | 0.16877638 | 3.050633 |
| Rectum | 71.3 | 28.7 | 2.4843206 | ||
| Salivary gland, cerebral | 12 | 37.6 | 50.3 | 0.23856859 | 0.7475149 |
| Salivary gland, thoracic | 73.4* | 4.6* | 22 | 3.3363636 | 0.2090909 |
| Sternite | 21.5 | 31.3 | 47.2 | 0.45550847 | 0.6631356 |
| Tergite | 27.4 | 36.8 | 35.9 | 0.7632312 | 1.0250696 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 43.7 | 37 | 19.3 | 2.2642486 | 1.9170984 |
| Malpighian tubules | 34.3 | 30.3 | 35.4 | 0.96892655 | 0.8559322 |
| Nerve chord | 39.8 | 17.1 | 43.1 | 0.9234339 | 0.39675173 |
| Poison sac | 51.3 | 48.7 | 1.0533881 | ||
| Sting | 57.8 | 42.2 | 1.3696682 | ||
| Heart | 34.3 | 24.6 | 41.1 | 0.8345499 | 0.5985401 |
| Hypopharyngeal gland | 39.6 | 60.4 | 0.65562916 | ||
| Galea | 26.1 | 35.8 | 38.1 | 0.68503934 | 0.93963253 |
| Glossa | 32.5 | 31 | 36.4 | 0.89285713 | 0.85164833 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.9 | 35.9 | 38 | 0.8657895 | 0.94473684 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASQTQGIQQLLAAEKRAAEKVAEARKRKARRLKQAKEEAQDEIEKYRQEREKQFREFEA KHMGSKEDVAARIEADTKIKTEEMNQTVSMHKDSVVHTILELVYDIKAELHKNYRAEI |
 Top
| |