| Protein: 66517653 XP_625017.1 PREDICTED: acylphosphatase-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57.5 | 42.5 | 1.3529412 | ||
| Scape | 31.7 | 23.8 | 44.5 | 0.71235955 | 0.53483146 |
| Brain | 65.3 | 34.7 | 1.8818444 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 41.3 | 58.7 | 0.7035775 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 56.2 | 16.1 | 27.7 | 2.0288808 | 0.5812274 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 25 | 57.3 | 17.7 | 1.4124293 | 3.2372882 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.3 | 40.6 | 37.6 | 1.125 | 1.0797873 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVQLIGVDFEVFGRVQGVFFRKYTQKHGNELGLKGWCMNTDKGTVIGRLEGEKNKIEEMK NWLRYTGSPQSAIDKAEFRNEKEISKISFNNFEIKK |
 Top
| |