| Protein: 66538476 XP_624247.1 PREDICTED: calmodulin-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.5 | 33.2 | 34.3 | 0.94752187 | 0.96793 |
| Scape | 41.9 | 22.7 | 35.3 | 1.1869688 | 0.6430595 |
| Brain | 37.2 | 28.6 | 34.2 | 1.0877193 | 0.83625734 |
| Crop | 59.5 | 17 | 23.5 | 2.531915 | 0.7234042 |
| Eye | 19.5 | 32.5 | 48 | 0.40625 | 0.6770833 |
| Intestine | 41.4 | 38 | 20.7 | 2 | 1.8357488 |
| Leg, front | 41.6 | 32.2 | 26.3 | 1.5817491 | 1.2243346 |
| Leg, middle | 40.6 | 32.5 | 26.9 | 1.5092937 | 1.2081784 |
| Leg, rear | 45.1 | 38.4 | 16.5 | 2.7333333 | 2.3272727 |
| Mandibular gland | 5.6 | 49 | 45.4 | 0.12334802 | 1.0792952 |
| Rectum | 26.8 | 26.9 | 46.3 | 0.5788337 | 0.58099353 |
| Salivary gland, cerebral | 25 | 47.6 | 27.5 | 0.90909094 | 1.7309091 |
| Salivary gland, thoracic | 49.8 | 19 | 31.1 | 1.6012862 | 0.61093247 |
| Sternite | 36.9 | 28.6 | 34.5 | 1.0695652 | 0.8289855 |
| Tergite | 60.2 | 39.8 | 1.5125629 | ||
| Ventriculus | 47.5 | 52.5 | 0.9047619 | ||
| Thoracic muscle | |||||
| Fat body | 56.7 | 43.3 | 1.3094689 | ||
| Malpighian tubules | 27 | 38 | 34.9 | 0.77363896 | 1.0888252 |
| Nerve chord | 36 | 21.7 | 42.4 | 0.8490566 | 0.5117925 |
| Poison sac | |||||
| Sting | |||||
| Heart | 71.6 | 28.4 | 2.5211267 | ||
| Hypopharyngeal gland | |||||
| Galea | 38.1 | 24.2 | 37.7 | 1.0106101 | 0.64190984 |
| Glossa | 56* | 26 | 18 | 3.1111112 | 1.4444444 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.4 | 31.8 | 34 | 1.1882353 | 0.9352941 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK |
 Top
| |