| Protein: 58585076 NP_001011563.1 juvenile hormone esterase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 71.5* | 14.4 | 14.1 | 5.070922 | 1.0212766 |
| Scape | 83.7* | 13.3* | 3 | 27.9 | 4.4333334 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 36.1 | 63.9 | 0.5649452 | ||
| Leg, front | |||||
| Leg, middle | 94.1* | 5.9 | 15.949153 | ||
| Leg, rear | 27.8 | 58.4* | 13.8 | 2.0144928 | 4.231884 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 86.5* | 13.5 | 6.4074073 | ||
| Sternite | 4.4* | 43.8 | 51.8 | 0.08494209 | 0.84555984 |
| Tergite | 0.5* | 67.2 | 32.2 | 0.01552795 | 2.0869565 |
| Ventriculus | 8.6* | 91.4 | 0.09409191 | ||
| Thoracic muscle | |||||
| Fat body | 1* | 32.3 | 66.7 | 0.014992504 | 0.48425788 |
| Malpighian tubules | 11.6* | 44.2 | 44.2 | 0.26244345 | 1 |
| Nerve chord | 85.2* | 14.8 | 5.756757 | ||
| Poison sac | |||||
| Sting | 42.6 | 57.4 | 0.74216026 | ||
| Heart | 1.3* | 31 | 67.8 | 0.019174041 | 0.45722714 |
| Hypopharyngeal gland | 26 | 74 | 0.35135135 | ||
| Galea | 75.4* | 24.6 | 3.0650406 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.2 | 47.5 | 39.9 | 0.6315789 | 1.1904762 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKLLFLVLLSSLVTFGWTLEDAPRVKTPLGAIKGYYKISGNGKQYEAYEGIPYALPPVGK FRFKAPQKIPAWIGELSATKFGFPCLQYTQLPVNPRDKIEGAEDCLYLNVYVPADRTPSQ SLPVIFWIHGGAFQFGSGIPMGAKYLMDSDVIFVTINYRLGILGFLSTEDEVVPGNMGLK DQSMALRWVSENIEWFGGNPKRITLIGLSAGGASVHYHYLSPLSAGLFQGGISISGTALN CWTQTENSLEKAKQVGAFMGCPTRNVKEMIRCLRYRPARAIVETLANFMRFYYNPFTPFG PVTEKVNNDSNSLPFIDRTPIEIINSGDVQDVPWVTGVTSEEGLYPVAEFIAKPEALKLL DENWDLIAPYFLDYNYTIPKEKHVEVARLIRNYYFESNKIDETTLKHLIDVASDRFFITD GEKAARMQAKVNRQPVWFYYYTYKGAHSISEIMSGTSNKYGVCHADDAYMVVDTPFLAST TTTNDIKMQKVLIDFWVSFVNNGVPNVNSVQWPRLNPNEKSLHYLHIAGPGKIQMDSSTN FGREDFWNSINFNENKLHTSDTLKEEL |
 Top
| |