| Protein: 66512029 XP_624508.1 PREDICTED: ubiquinone biosynthesis protein COQ9 mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.8 | 55.2 | 0.8115942 | ||
| Scape | 23.2 | 48.9 | 27.9 | 0.83154124 | 1.7526882 |
| Brain | |||||
| Crop | 36.8 | 63.2 | 0.5822785 | ||
| Eye | |||||
| Intestine | 13.7 | 30.8 | 55.5 | 0.24684684 | 0.55495495 |
| Leg, front | 67.1 | 32.9 | 2.0395136 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 14.7 | 36.9 | 48.4 | 0.303719 | 0.7623967 |
| Salivary gland, thoracic | 42.8 | 21.3 | 35.8 | 1.1955308 | 0.5949721 |
| Sternite | 64.1 | 35.9 | 1.7855153 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 44.4 | 55.6 | 0.79856116 | ||
| Fat body | 6.6 | 66 | 27.5 | 0.24 | 2.4 |
| Malpighian tubules | 39.3 | 25 | 35.6 | 1.1039326 | 0.7022472 |
| Nerve chord | 27.9 | 32.7 | 39.3 | 0.7099237 | 0.83206105 |
| Poison sac | |||||
| Sting | 72.4 | 27.6 | 2.6231885 | ||
| Heart | 25.9 | 29.7 | 44.4 | 0.5833333 | 0.6689189 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 59.1 | 40.9 | 1.4449878 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.1 | 44.3 | 41.7 | 0.74580336 | 1.0623502 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAMSSILLMRKGLSVNGFRSLWTCRVLFNDQIKNDTQKSNQKYKNNESEEEYEKNIKSKI LDASLKYVHDLGWSHKAISAGAESIGYPGIIHGLFPNRGADLVQYFYLTCNKKLNNILKE QTLANQENPKETKTLLLEARNAVETRLRMVIPYKKTWPQALALMSLPPNVPMSLANLLTL VDDICYYAGDRSVDINWYTRRIVLAGIYKTTELYMIQDNSEDHQKTWHFLDRRIKDATQI QMILTTTSDMALPDQALNRATEAATAAFVTARNILGLNWNR |
 Top
| |