| Protein: 66546657 XP_623282.1 PREDICTED: protein disulfide-isomerase A3 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.5 | 27.4 | 28.1 | 1.5836298 | 0.97508895 |
| Scape | 41 | 31.6 | 27.4 | 1.4963504 | 1.1532847 |
| Brain | 44.4 | 55.6 | 0.79856116 | ||
| Crop | 22.5 | 39.8 | 37.7 | 0.59681696 | 1.0557029 |
| Eye | 45.2 | 32.6 | 22.2 | 2.036036 | 1.4684684 |
| Intestine | 30.3 | 45.1 | 24.6 | 1.2317073 | 1.8333334 |
| Leg, front | 38.8 | 37.4 | 23.8 | 1.6302521 | 1.5714285 |
| Leg, middle | 30.8 | 41.2 | 28.1 | 1.0960854 | 1.4661921 |
| Leg, rear | 36.3 | 43.1 | 20.5 | 1.7707317 | 2.102439 |
| Mandibular gland | 22.1 | 77.9 | 0.28369704 | ||
| Rectum | 6.4 | 50.3 | 43.2 | 0.14814815 | 1.1643518 |
| Salivary gland, cerebral | 70.5 | 11.6 | 17.9 | 3.9385474 | 0.6480447 |
| Salivary gland, thoracic | 48.3 | 16.4 | 35.3 | 1.368272 | 0.46458924 |
| Sternite | 30.9 | 43.9 | 25.2 | 1.2261904 | 1.7420635 |
| Tergite | 15 | 66.6 | 18.4 | 0.8152174 | 3.6195652 |
| Ventriculus | 11.8 | 68.9 | 19.3 | 0.61139894 | 3.5699482 |
| Thoracic muscle | |||||
| Fat body | 60.8 | 23.2 | 16 | 3.8 | 1.45 |
| Malpighian tubules | 38.1 | 29.9 | 32 | 1.190625 | 0.934375 |
| Nerve chord | 50.2 | 25.6 | 24.2 | 2.0743802 | 1.0578512 |
| Poison sac | 52.8 | 47.2 | 1.1186441 | ||
| Sting | 45.6 | 54.4 | 0.8382353 | ||
| Heart | 26.9 | 44.3 | 28.8 | 0.9340278 | 1.5381944 |
| Hypopharyngeal gland | 21.8 | 78.2 | 0.27877238 | ||
| Galea | 48.3 | 16.1 | 35.7 | 1.3529412 | 0.4509804 |
| Glossa | 29.9 | 13.3 | 56.8 | 0.52640843 | 0.23415492 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 36.4 | 35.1 | 1.017094 | 1.037037 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLFKYFNFLFLVFASVLAEEKDVVELTDETFSHELERLENTLVMFYAPWCGHCKRLKPEY AKAAEMLLDNDPSITLAKVDCTESGKDTCNKYSVSGYPTLKIFSKGDFVSDYNGPREAVG IAKYMKAQVGPASKELNEENCLKSFLDSDEVSVVGFFEKEDLSLATTFHAVSKKLKEKVR FAHTTAKSLMEKEGYKNTIVLYRPKILQNKFEANIVKYDETMGDIQEFINKNYFGIAGVR TRDNTAEFKNPLVVAYYAVDYIKNPKGTNYWRNRIIKVAKDFPNLNFAISSKDDFQHELN DFGIDFVKGDKPVILARNINNQKFVMKDEFSVSTFEAFLKDMEAGVLEPYLKSEPIPEDN SGNVKIAVARNFDELVTNNDKDTLIEFYAPWCGHCKKLAPVYDELGEKLANEDVEIIKFD ATANDVPGPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKG KSVKPKSDEL |
 Top
| |