| Protein: 328786067 XP_003250703.1 PREDICTED: glutaredoxin-C4 isoform 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 70.5 | 29.5 | 2.3898306 | ||
| Scape | 32.5 | 26.4 | 41.1 | 0.79075426 | 0.6423358 |
| Brain | 62.1 | 37.9 | 1.6385224 | ||
| Crop | 41.7 | 58.3 | 0.71526587 | ||
| Eye | |||||
| Intestine | 17.4 | 52 | 30.6 | 0.5686275 | 1.6993464 |
| Leg, front | 37.4 | 35.4 | 27.2 | 1.375 | 1.3014706 |
| Leg, middle | 24.5 | 47.6 | 27.9 | 0.8781362 | 1.7060932 |
| Leg, rear | 35 | 33.8 | 31.2 | 1.1217948 | 1.0833334 |
| Mandibular gland | 14.4 | 85.6 | 0.1682243 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.7 | 29.6 | 36.7 | 0.9182561 | 0.80653954 |
| Sternite | |||||
| Tergite | 64.7 | 35.3 | 1.8328612 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.2 | 32.6 | 35.2 | 0.91477275 | 0.9261364 |
| Malpighian tubules | 21.1 | 39.4 | 39.5 | 0.53417724 | 0.99746835 |
| Nerve chord | 14 | 56.2 | 29.8 | 0.46979865 | 1.885906 |
| Poison sac | |||||
| Sting | 43.7 | 56.3 | 0.7761989 | ||
| Heart | 26.1 | 42 | 31.9 | 0.8181818 | 1.3166144 |
| Hypopharyngeal gland | 42.7 | 57.3 | 0.7452007 | ||
| Galea | |||||
| Glossa | 46.9 | 53.1 | 0.88323915 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.6 | 42.1 | 41.4 | 0.7874396 | 1.0169082 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNFTKENAMPTTKEEVNQLIASHSIVIFSKTSCPFCKMAKQVFHNLQKEYTAIELNERN DGDEIQSILGEMTGARTVPRVFVNGVCLGGGTDVKKLYETGELQKMF |
 Top
| |