| Protein: 328777202 XP_003249300.1 PREDICTED: sex-regulated protein janus-A-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.7 | 49.3 | 1.0283976 | ||
| Scape | 29.2 | 35 | 35.8 | 0.8156425 | 0.9776536 |
| Brain | |||||
| Crop | 48.8 | 13.9 | 37.3 | 1.308311 | 0.37265417 |
| Eye | 33.5 | 4.3* | 62.3 | 0.5377207 | 0.06902087 |
| Intestine | 23.6 | 38.1 | 38.4 | 0.6145833 | 0.9921875 |
| Leg, front | 28.9 | 45 | 26.1 | 1.1072797 | 1.7241379 |
| Leg, middle | 29.4 | 42.4 | 28.2 | 1.0425532 | 1.5035461 |
| Leg, rear | 25.8 | 47.5 | 26.7 | 0.96629214 | 1.7790263 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 38.7 | 21.2 | 40.1 | 0.9650873 | 0.5286783 |
| Salivary gland, thoracic | 31.4 | 33.7 | 34.9 | 0.89971346 | 0.96561605 |
| Sternite | 53.4 | 31.8 | 14.8 | 3.608108 | 2.1486487 |
| Tergite | 75.3 | 24.7 | 3.048583 | ||
| Ventriculus | |||||
| Thoracic muscle | 86.2 | 13.8 | 6.246377 | ||
| Fat body | 82.8 | 17.2 | 4.8139534 | ||
| Malpighian tubules | 34.2 | 29.6 | 36.2 | 0.9447514 | 0.8176796 |
| Nerve chord | 34.1 | 35.4 | 30.5 | 1.1180328 | 1.1606557 |
| Poison sac | |||||
| Sting | 55.8 | 44.2 | 1.2624434 | ||
| Heart | 51.4 | 22.7 | 25.9 | 1.984556 | 0.87644786 |
| Hypopharyngeal gland | 58 | 42 | 1.3809524 | ||
| Galea | 7* | 40.1 | 52.9 | 0.13232514 | 0.75803405 |
| Glossa | 15.5 | 53.1 | 31.4 | 0.49363056 | 1.6910828 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 38.6 | 33.9 | 1.1356932 | 1.138643 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAESLKNFGSVVFNNRHIIFKAIFSNTKQFVTMSESLNKVPDVDIDGHGRFKYILINVFD EANNVSKSIVRGYARAQWHNDIFDEAGEQVKPISGLQLKCLGGGRIEHDPDNKTIKVFGY SQGFGKADHEVSVNILKKYYPDYSITWSDDGY |
 Top
| |