| Protein: 328789605 XP_001121743.2 PREDICTED: protein Kr-h2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.3 | 36.6 | 36.1 | 0.7562327 | 1.0138505 |
| Scape | 34.1 | 65.9 | 0.5174507 | ||
| Brain | |||||
| Crop | 55.1 | 44.9 | 1.2271715 | ||
| Eye | |||||
| Intestine | 48.7 | 51.3 | 0.94931775 | ||
| Leg, front | 32.1 | 67.9 | 0.47275406 | ||
| Leg, middle | 30.5 | 69.5 | 0.4388489 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 47.2 | 10.7 | 42.1 | 1.1211401 | 0.25415677 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.5 | 18.2 | 45.3 | 0.8057395 | 0.401766 |
| Malpighian tubules | 71.5 | 28.5 | 2.508772 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.1 | 36.6 | 50.2 | 0.7589641 | 0.72908366 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKMADTASSNSVHMEKGWGALRQHIIDNKIKAALWVTRLFTIIFTIGYIIQIFGNPYNIY YKILMNNAATSALRLHQRVPHVQLNRQFLERLFVEDSCHYLLYSLIFLYTAPVTLVLTPI FLFALMHFASDSLTLLDCLGQNSWWGARLLISLIEFQSRNILRLCGLFEIIILPFTVLLV FTGRASLLTPFIYFQFLKFRLASQRNPFTRNVFYEIRNGLSSVSRKPTVPIIIRQIIEDV GCEGKTSSFGSTIETESGRGFLGPVLP |
 Top
| |