| Protein: 66558956 XP_392812.2 PREDICTED: 60S ribosomal protein L23 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 59.4 | 40.6 | 1.4630542 | ||
| Scape | 41.6 | 38.8 | 19.6 | 2.122449 | 1.9795918 |
| Brain | 57.9 | 42.1 | 1.375297 | ||
| Crop | 35.2 | 64.8 | 0.54320985 | ||
| Eye | |||||
| Intestine | 45.5 | 33.4 | 21 | 2.1666667 | 1.5904762 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 22.6 | 77.4 | 0.29198965 | ||
| Rectum | |||||
| Salivary gland, cerebral | 72.9 | 3 | 24.1 | 3.0248964 | 0.12448133 |
| Salivary gland, thoracic | 44.5 | 8.8 | 46.8 | 0.9508547 | 0.18803419 |
| Sternite | |||||
| Tergite | 51.3 | 40.2 | 8.6 | 5.9651165 | 4.6744184 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 37.2 | 35.8 | 27 | 1.3777778 | 1.325926 |
| Malpighian tubules | 41.1 | 23.5 | 35.4 | 1.161017 | 0.6638418 |
| Nerve chord | 48.6 | 17.8 | 33.7 | 1.4421365 | 0.5281899 |
| Poison sac | |||||
| Sting | |||||
| Heart | 18.3 | 51.5 | 30.2 | 0.60596025 | 1.7052981 |
| Hypopharyngeal gland | 10.8 | 89.2 | 0.12107623 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.3 | 26.4 | 40 | 1.1075 | 0.66 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDM IVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGP VAKECADLWPRIASNASSIA |
 Top
| |