![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 48110113 XP_396259.1 PREDICTED: vesicle transport protein GOT1B-like isoform 2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.4 | 48.6 | 1.0576131 | ||
| Scape | 7 | 93 | 0.07526882 | ||
| Brain | 32.5 | 67.5 | 0.4814815 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28 | 72 | 0.3888889 | ||
| Sternite | 38 | 62 | 0.61290324 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 46.1 | 20.2 | 33.7 | 1.3679525 | 0.59940654 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 84.6* | 15.4 | 5.4935064 | ||
| Hypopharyngeal gland | 24.3 | 75.7 | 0.32100397 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.5 | 34.8 | 58.5 | 0.6752137 | 0.5948718 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFEITDTQKIGVGLVGFGISFLFLGVLLLFDKGLLAIGNILFISGLACVIGPKRTLSFFF QKHKIKASASFLGGIIVVLMGWPIIGMIIETYGFVLLFSGFLPVAINVLRKVPGLRIILN LPGISKILDSVAGDPNRTTV |
|
| |