| Protein: 58585214 NP_001011636.1 FABP-like protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.5* | 38.4 | 20.1 | 2.0646765 | 1.9104477 |
| Scape | |||||
| Brain | 72.7* | 7.3 | 20 | 3.635 | 0.365 |
| Crop | 7.4* | 92.6 | 0.07991361 | ||
| Eye | 1.1* | 98.9 | 0.011122346 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 62 | 24.2 | 13.8 | 4.4927535 | 1.7536232 |
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 64.6* | 13.3 | 22.1 | 2.9230769 | 0.60181 |
| Poison sac | |||||
| Sting | 11.1 | 88.9 | 0.12485939 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.5 | 18.9 | 50.9 | 0.8153242 | 0.3713163 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVQFEGKFQFVSQNNFEEFAKVLGDQNLVNTVLQPRPSFELSKNGDEWTFTSSSGDNTYT KTFKMNVPFEETLPSLPDRKFQTVTSIEGNTFKTETQVNDSLKVTRLYEFSDNELLVHIS TNKSDVKATRVYKRV |
 Top
| |