| Protein: 328793133 XP_393092.2 PREDICTED: 60S ribosomal protein L10 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 18.5* | 81.5 | 0.22699386 | ||
| Scape | 42.4 | 34.3 | 23.3 | 1.8197424 | 1.472103 |
| Brain | |||||
| Crop | 18.6 | 43.2 | 38.1 | 0.48818898 | 1.1338583 |
| Eye | 54.3 | 45.7 | 1.1881838 | ||
| Intestine | 49.9 | 50.1 | 0.996008 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 72.2 | 27.8 | 2.5971222 | ||
| Salivary gland, cerebral | 91.3 | 8.7 | 10.494253 | ||
| Salivary gland, thoracic | 44.8 | 11.5 | 43.6 | 1.0275229 | 0.26376146 |
| Sternite | 70.3 | 29.7 | 2.3670034 | ||
| Tergite | 91 | 9 | 10.111111 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.9 | 32.6 | 36.5 | 0.8465753 | 0.8931507 |
| Malpighian tubules | 36.9 | 25 | 38.1 | 0.96850395 | 0.656168 |
| Nerve chord | 48.6 | 21.6 | 29.8 | 1.6308725 | 0.72483224 |
| Poison sac | |||||
| Sting | 52.2 | 47.8 | 1.0920502 | ||
| Heart | 17.6 | 54.6 | 27.8 | 0.63309354 | 1.9640288 |
| Hypopharyngeal gland | 13 | 87 | 0.14942528 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.2 | 37.1 | 39 | 1.2615385 | 0.951282 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKKASVEDFPLCVHLVSDEYEQLSSEALE AGRICANKYMVKNAGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTV ARVHIGQPIMSVRSSDRHKAAVVEALRRAKFKFPGRQKIYVSKKWGFTKYDRAEYEELKA AGRLAPDGCNVKYLPEHGPLDEWKKFRKVLAAA |
 Top
| |