| Protein: 48098249 XP_392027.1 PREDICTED: chloride intracellular channel exc-4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.1 | 31.9 | 37 | 0.8405405 | 0.8621622 |
| Scape | 25.6 | 42 | 32.4 | 0.79012346 | 1.2962962 |
| Brain | |||||
| Crop | 51.7 | 48.3 | 1.0703933 | ||
| Eye | |||||
| Intestine | 29 | 38.1 | 32.9 | 0.88145894 | 1.1580547 |
| Leg, front | 34.3 | 32.7 | 33 | 1.0393939 | 0.9909091 |
| Leg, middle | 48.3 | 51.7 | 0.934236 | ||
| Leg, rear | 36.7 | 35.5 | 27.8 | 1.3201439 | 1.2769784 |
| Mandibular gland | 72.4 | 27.6 | 2.6231885 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 56.2 | 7.1* | 36.7 | 1.5313351 | 0.1934605 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.6 | 22.5 | 35.9 | 1.1587744 | 0.62674093 |
| Malpighian tubules | 35.9 | 40.4 | 23.7 | 1.5147679 | 1.7046413 |
| Nerve chord | 83.3* | 16.7 | 4.9880238 | ||
| Poison sac | |||||
| Sting | 57.6 | 42.4 | 1.3584906 | ||
| Heart | 56.6 | 43.4 | 1.3041475 | ||
| Hypopharyngeal gland | 39 | 61 | 0.6393443 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.1 | 41.4 | 36.7 | 1.119891 | 1.1280653 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADDSHENGTSNGDVPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTT VDMQKPPPDFRTNFQATPPPILIDNGDAILENEKIERHIMKNIPGGHNLFVQDKEVATLV ENLFSKLKLLLLNAKDKDKDPKSSSLMAHLRKIDEHLGRKGTRFLTGDTMCCFDCELMPR LQHIRVAGKYFADFEIPETLVHLWRYMHHMYRLDAFLQSCPADQDIINHYKLQQSMKMKK HEELETPTFTTSIPIEVNDD |
 Top
| |