| Protein: 66512834 XP_395069.2 PREDICTED: uridine phosphorylase 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.1 | 45.9 | 1.1786492 | ||
| Scape | 53.5 | 10.5 | 36 | 1.4861112 | 0.29166666 |
| Brain | 42.5 | 57.5 | 0.73913044 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 74.8* | 4.8 | 20.5 | 3.6487806 | 0.23414634 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 22.9 | 26 | 51.1 | 0.4481409 | 0.5088063 |
| Poison sac | 82.2 | 17.8 | 4.6179776 | ||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 8.3 | 91.7 | 0.090512544 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 51.3 | 29.1 | 45.8 | 1.1200874 | 0.6353712 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPTCACENRILDEESHECQLKPPIENDEEETQEYDPAVRYRDGSVRLRNPNIELMDQDIL YHLALGSGSHDLVEMFGDVKFVCMGGTPKRMEQFANYIMKEIGHKLPAGTTLLDISQYSY RYSMYKVGPVLSISHGMGIPSVGILLHEVIKLMYHAKVKDPIFFRIGTCGGIGLEGGTVV ISEEAVDGMLKSYLELPVLGKMVRRPAKLDRQLARDLKTLAHRDNPYDTIIGKTMCTYDF YEGQGRMDGAFCEFTENEKIEYLNKLHKAGVINIEMESLAFAALTHHAGIKAAVVCVTLI DRFKGDQVLAPKEVLDEWQIRPQELIARYITRYLQRKGRLSLEGHGSMCVKSPRRFKLVQ QESENYD |
 Top
| |