| Protein: 66530260 XP_395917.2 PREDICTED: cystathionine gamma-lyase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.6 | 45 | 30.4 | 0.80921054 | 1.4802631 |
| Scape | 34.3 | 10.1 | 55.6 | 0.61690646 | 0.18165468 |
| Brain | 28.5 | 71.5 | 0.3986014 | ||
| Crop | 46.7 | 53.3 | 0.8761726 | ||
| Eye | |||||
| Intestine | 27 | 35.1 | 37.9 | 0.71240103 | 0.92612135 |
| Leg, front | 23.5 | 49 | 27.5 | 0.8545455 | 1.7818182 |
| Leg, middle | 28.1 | 43 | 28.9 | 0.97231835 | 1.4878893 |
| Leg, rear | 44.6 | 35.6 | 19.8 | 2.2525253 | 1.7979798 |
| Mandibular gland | 22.7 | 77.3 | 0.29366106 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 42.5 | 18.5 | 39.1 | 1.0869565 | 0.47314578 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 47.1 | 52.9 | 0.89035916 | ||
| Malpighian tubules | 28.2 | 45.1 | 26.7 | 1.0561798 | 1.6891385 |
| Nerve chord | 81.1 | 18.9 | 4.291005 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 9.2 | 52.1 | 38.7 | 0.23772609 | 1.3462533 |
| Hypopharyngeal gland | 58.1 | 41.9 | 1.3866348 | ||
| Galea | |||||
| Glossa | 70.6 | 29.4 | 2.4013605 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.5 | 44.4 | 40.6 | 0.70197046 | 1.0935961 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEQGFSTKAIHAGQDPLQWNDCSVIPPITLSTTFQQDGPGQPRTFIYGRSGNPTRNVLQT CLAALEDGKYGFVFSSGLGATTVLISLLNAGDHIISGDDIYGGTNRFFKNCLKNISVTFV DMIDINNIITNIQPNTKMIWLETPTNPLLKVIDIEAVTQAVKQVNSEILVVVDNTFLTCY YQKPLKLGADIVIYSLTKYMNGHSDVIMGAAITNREDIANRLRFLQNAMGIVSSPLDCFL VNRSLKTLELRMQQHMKHGLAVAVFLQSHPCVEKVIHPYLPSHPQHEIAIKQTSGHSGMV SFYLKGDSSKFLKALKVFTLAESLGGYESLAELPSVMTHASIPEETKEMLGINDKLIRLS VGLETERDILADLDQALKASQ |
 Top
| |