| Protein: 66565246 XP_393161.2 PREDICTED: lysozyme isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 76* | 24 | 3.1666667 | ||
| Scape | |||||
| Brain | |||||
| Crop | 63.3 | 36.7 | 1.7247957 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 11.8 | 88.2 | 0.13378684 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 23.9 | 60.3 | 15.8 | 1.5126582 | 3.8164556 |
| Poison sac | |||||
| Sting | 52.2 | 47.8 | 1.0920502 | ||
| Heart | |||||
| Hypopharyngeal gland | 86.7 | 13.3 | 6.518797 | ||
| Galea | 66 | 34 | 1.9411764 | ||
| Glossa | 40.7 | 59.3 | 0.68634063 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.9 | 63.2 | 39.9 | 0.84962404 | 1.5839599 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTFLLNSSGITCLLLSLIYEQQTLVMATEMVPRVCLGCICEAASGCNITIGCDESVCGPF RITWNYWADAGKPTLDDNLNENAYARCVNDPYCAARTVQGYMMKFAQDCNNDGNINCDDF LRIHRLGGYGCNGSLNSKYENIYKLCMQTFEKQ |
 Top
| |