| Protein: 66503873 XP_624697.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.5 | 59.5 | 0.6806723 | ||
| Scape | 29.4 | 44.4 | 26.1 | 1.1264368 | 1.7011495 |
| Brain | |||||
| Crop | 48.2 | 51.8 | 0.93050194 | ||
| Eye | |||||
| Intestine | 60 | 40 | 1.5 | ||
| Leg, front | 35.7 | 64.3 | 0.55520993 | ||
| Leg, middle | 36.5 | 33.6 | 29.9 | 1.2207358 | 1.1237458 |
| Leg, rear | 66.5 | 33.5 | 1.9850746 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 45.1 | 54.9 | 0.8214936 | ||
| Salivary gland, thoracic | 20.8 | 40.4 | 38.9 | 0.5347044 | 1.0385604 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 20.2 | 31.1 | 48.7 | 0.4147844 | 0.6386037 |
| Malpighian tubules | 26.2 | 32.2 | 41.7 | 0.6282974 | 0.7721822 |
| Nerve chord | 18.9 | 39.7 | 41.4 | 0.45652175 | 0.9589372 |
| Poison sac | |||||
| Sting | |||||
| Heart | 15.9 | 48.9 | 35.2 | 0.45170453 | 1.3892045 |
| Hypopharyngeal gland | 45.5 | 54.5 | 0.8348624 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 42.1 | 44.3 | 0.6884876 | 0.9503386 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPLENLEEEGLEKNPNLELAQTKFLLSLPEHKDDPYLKNKLLDAIKAENMAPFYEEVCKD LNWPVDDTLLTSMKTKNMEQLKELDDAIEDAEKNLGEMEVREANLKKSEHLCRIGDKEGS ISAFKKTYDKTVSLGHRLDIVFHNIRIGLFYLDHDHVTRNIEKAKSLIEEGGDWDRRNRL KVYQGTYCIAVRDFKEAANFFLDTISTFTSYELMDYNTFVRYTVYLSMISLPRNELRDKI IKGSEILEVLHSNPDVKDYLFSLYNCQYADFFKNLAHVEGLLRRDYLIFPHYRYYVREMR ILAYTQLLESYRSLTLQYMAEAFGVTVEYIDQELSRFIAAGRLHCKVDRVGGVVETNRPD SKNWQYQAMVKQGDLLLNRVQKLSRVINI |
 Top
| |