| Protein: 66564438 XP_624692.1 PREDICTED: glutathione S-transferase theta-1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57 | 43 | 1.3255814 | ||
| Scape | 27.5 | 43.5 | 29 | 0.94827586 | 1.5 |
| Brain | |||||
| Crop | 65.2 | 34.8 | 1.8735632 | ||
| Eye | |||||
| Intestine | 35.7 | 64.3 | 0.55520993 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 74.7 | 25.3 | 2.9525692 | ||
| Salivary gland, thoracic | 9.7* | 54.6 | 35.7 | 0.2717087 | 1.5294118 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 34.4 | 65.6 | 0.5243902 | ||
| Fat body | 12.3 | 49.1 | 38.6 | 0.31865284 | 1.2720207 |
| Malpighian tubules | 19.8 | 50.1 | 30.1 | 0.6578073 | 1.6644518 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 22.8 | 37.3 | 39.9 | 0.5714286 | 0.9348371 |
| Hypopharyngeal gland | 90 | 10 | 9 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 53.2 | 37.8 | 0.8544974 | 1.4074074 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLKLYYDLLSQPSRTLYIFLKICDIPFEAKLINLAKGEQFISKYQNIHPFQKVPAIEHN GFNMIESVAILRYICREFNVADHWYPKDSKLQLRVDEYLEWHHLNTRLHCSMYFLKKFLI PKLSGQETTVTQENIMKYEKNMIKILDVLENVWLKDKIFLTGSEISIADILAACEVEQVR IVGYNLQENRPRIAAWMKYVENKTSPYYQEAHIFLNKLATKTKQDVKSKI |
 Top
| |