| Protein: 66521459 XP_623725.1 PREDICTED: voltage-dependent anion-selective channel |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.5 | 31.2 | 35.3 | 0.9490085 | 0.8838527 |
| Scape | 43.9 | 23.9 | 32.2 | 1.3633541 | 0.742236 |
| Brain | 31.5 | 32.1 | 36.3 | 0.8677686 | 0.88429755 |
| Crop | 31.5 | 30.4 | 38.1 | 0.8267717 | 0.79790026 |
| Eye | 35.4 | 19.7 | 44.9 | 0.7884187 | 0.43875277 |
| Intestine | 32.5 | 31.2 | 36.3 | 0.8953168 | 0.8595041 |
| Leg, front | 30.1 | 39.1 | 30.7 | 0.98045605 | 1.2736156 |
| Leg, middle | 32.7 | 40.9 | 26.4 | 1.2386364 | 1.5492424 |
| Leg, rear | 19.8 | 32.6 | 47.6 | 0.4159664 | 0.68487394 |
| Mandibular gland | 27.2 | 12.8 | 60 | 0.45333332 | 0.21333334 |
| Rectum | 37.9 | 35.1 | 27.1 | 1.3985239 | 1.295203 |
| Salivary gland, cerebral | 22 | 34.3 | 43.7 | 0.5034325 | 0.784897 |
| Salivary gland, thoracic | 39.6 | 29.4 | 31 | 1.2774193 | 0.9483871 |
| Sternite | 27.8 | 35.3 | 36.9 | 0.7533875 | 0.9566396 |
| Tergite | 26.6 | 33.2 | 40.2 | 0.66169155 | 0.82587063 |
| Ventriculus | 32.8 | 22.9 | 44.3 | 0.74040633 | 0.51693004 |
| Thoracic muscle | 31.5 | 40.9 | 27.6 | 1.1413044 | 1.481884 |
| Fat body | 20.9 | 53.8 | 25.3 | 0.82608694 | 2.1264822 |
| Malpighian tubules | 32.6 | 32.7 | 34.7 | 0.93948126 | 0.9423631 |
| Nerve chord | 43.2 | 18.1 | 38.7 | 1.1162791 | 0.46770027 |
| Poison sac | 49.5 | 50.5 | 0.980198 | ||
| Sting | 43.7 | 56.3 | 0.7761989 | ||
| Heart | 33.4 | 27.7 | 38.9 | 0.8586118 | 0.71208227 |
| Hypopharyngeal gland | 85.1 | 14.9 | 5.7114096 | ||
| Galea | 42.3 | 12.5 | 45.2 | 0.9358407 | 0.27654868 |
| Glossa | 42.9 | 8.4* | 48.7 | 0.8809035 | 0.1724846 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.7 | 32.9 | 38.1 | 0.8582677 | 0.86351705 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAPPSYNDLGKSARDLFSSGYHFGLIKLDVKTKTKSGVEFSSGGVSNQDTGKVFGSLETK YNIDDYGLKFSEKWNTDNTLATDITFADKLLKGLTLGYGCTFSPQTGTKTGKLKTAYKHD NVSAAADFDLSLSTGPLVNASTVVGYQGWLAGYQACFDTQRNKLTKNNFALGYTASDFTL HAAVNNGCDFSGLIYHKVKPELEGAINLEWNSSNNVTQFGIATKYNLDNDASIRAKVNSN LQVGLGYQQKLRDGVTLTLSTNIDGKNFGSGGHKIGLALDLQA |
 Top
| |