| Protein: 328785988 XP_003250688.1 PREDICTED: ATP synthase subunit d mitochondrial isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.9 | 32.8 | 32.3 | 1.0804954 | 1.0154799 |
| Scape | 42 | 23.6 | 34.4 | 1.2209302 | 0.68604654 |
| Brain | 22.2 | 39.8 | 38 | 0.5842105 | 1.0473684 |
| Crop | 32 | 30.7 | 37.2 | 0.86021507 | 0.8252688 |
| Eye | 40.6 | 26.9 | 32.5 | 1.2492307 | 0.82769233 |
| Intestine | 31.6 | 27.2 | 41.1 | 0.76885647 | 0.6618005 |
| Leg, front | 36.2 | 26.6 | 37.2 | 0.9731183 | 0.71505374 |
| Leg, middle | 32.8 | 29.5 | 37.6 | 0.87234044 | 0.78457445 |
| Leg, rear | 22.3 | 33.5 | 44.2 | 0.5045249 | 0.75791854 |
| Mandibular gland | 26 | 14.3 | 59.7 | 0.43551087 | 0.23953098 |
| Rectum | 32.6 | 30.9 | 36.6 | 0.89071035 | 0.8442623 |
| Salivary gland, cerebral | 20.2 | 45.8 | 34 | 0.59411764 | 1.3470588 |
| Salivary gland, thoracic | 33.6 | 37.8 | 28.6 | 1.1748252 | 1.3216783 |
| Sternite | 22.6 | 36.6 | 40.8 | 0.5539216 | 0.89705884 |
| Tergite | 18.4 | 35.7 | 45.9 | 0.40087146 | 0.7777778 |
| Ventriculus | 8.7 | 38.9 | 52.4 | 0.16603054 | 0.74236643 |
| Thoracic muscle | 18.8 | 59.7 | 21.5 | 0.8744186 | 2.7767441 |
| Fat body | 24.4 | 51.3 | 24.4 | 1 | 2.102459 |
| Malpighian tubules | 37.6 | 23.7 | 38.6 | 0.97409326 | 0.61398965 |
| Nerve chord | 33.8 | 17.2 | 49 | 0.6897959 | 0.3510204 |
| Poison sac | 76.2 | 23.8 | 3.2016807 | ||
| Sting | 42.3 | 57.7 | 0.73310226 | ||
| Heart | 53.9 | 16.4 | 29.6 | 1.820946 | 0.5540541 |
| Hypopharyngeal gland | 90.5 | 9.5 | 9.526316 | ||
| Galea | 36.9 | 26.4 | 36.7 | 1.0054495 | 0.71934605 |
| Glossa | 38.4 | 26.8 | 34.8 | 1.1034483 | 0.77011496 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 36.2 | 36.9 | 0.8265583 | 0.9810298 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRKALKAINWSAITERIPSSEKAALTAFKSKSDRYLQRMMAYPEDLPKIDWTYYKKTII TPGLVDKFYKEYEAISIPYPTDKYTQAIDSEQKEIADKIQSFIQEVNSQIAELQQNLDRI KNMIPFSEMTMEDFSDIQPKGTLRPDEEPTTWPHTEDSQEKFGEKDDPKDKDNH |
 Top
| |