| Protein: 292494909 NP_001167616.1 apidermin 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 59 | 41 | 1.4390244 | ||
| Scape | 61.1 | 2.8 | 36.1 | 1.6925207 | 0.077562325 |
| Brain | |||||
| Crop | |||||
| Eye | 31.7 | 30.7 | 37.6 | 0.8430851 | 0.81648934 |
| Intestine | |||||
| Leg, front | 55.4* | 19.3 | 25.3 | 2.1897233 | 0.7628459 |
| Leg, middle | 61.2* | 24.3 | 14.5 | 4.22069 | 1.6758621 |
| Leg, rear | 15.8 | 38.9 | 45.2 | 0.34955752 | 0.8606195 |
| Mandibular gland | 51 | 28.3 | 20.7 | 2.463768 | 1.3671497 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 39.9 | 31.6 | 28.5 | 1.4 | 1.1087719 |
| Tergite | 55.8 | 44.2 | 1.2624434 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 45.7 | 26.1 | 28.1 | 1.6263345 | 0.9288256 |
| Glossa | 54.5* | 29.8 | 15.8 | 3.449367 | 1.886076 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.3 | 25.8 | 30.6 | 1.5784314 | 0.84313726 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKAFVVFACLAVATARAGIAHGPGYALAGGHGGYGGVGLAGVGLVGGGASLSGGLAAGAG SARSLQEGASSLGSSALGASYAAGSAAAAGAAGVQQIVSGGVIGGRADIGPAEGPKANVG PQSGPSDSVGPQEGAKNVGGPRTGPAGLVGPATGPFTSVGASAGTSTLVGPSQGAANLVG PSVGVVSFYAGSGNINGDDGSSGSAAAAAPGGLAGPALGLGGAGAIAVVGGGAAGYGAGL GGHDGGVAVINGPSGAIHAGLGSHGAIIPGALGKY |
 Top
| |