| Protein: 66546786 XP_623377.1 PREDICTED: inositol-3-phosphate synthase 1-B isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.8 | 38.9 | 33.3 | 0.8348348 | 1.1681682 |
| Scape | 28 | 35.2 | 36.8 | 0.76086956 | 0.95652175 |
| Brain | 39.5 | 60.5 | 0.6528926 | ||
| Crop | 78.7* | 21.3 | 3.6948357 | ||
| Eye | 29.4 | 39.2 | 31.4 | 0.93630576 | 1.2484076 |
| Intestine | 25.5 | 35.4 | 39 | 0.65384614 | 0.9076923 |
| Leg, front | 76.5* | 23.5 | 3.255319 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.7 | 26.3 | 40 | 0.8425 | 0.6575 |
| Sternite | 62.1 | 37.9 | 1.6385224 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 97.4* | 2.6 | 37.46154 | ||
| Malpighian tubules | |||||
| Nerve chord | 13.8 | 63.1 | 23.1 | 0.5974026 | 2.7316017 |
| Poison sac | |||||
| Sting | 93.6* | 6.4 | 14.625 | ||
| Heart | 86.9* | 13.1 | 6.633588 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.5 | 56.3 | 28.4 | 1.2852113 | 1.9823943 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALKIRVQSPKVKYTEDCIEAQYEYQTTNVTEDDTKYTVTPVSTKLLIRTQLKVPKLGLM LVGWGGNNGTTITAALLANKLKLTWDTKNGIQKANWYGSLIQASTIRLGKGNKEDIYVPM SWMLPMVNPDDIQIDGWDISDMNLADAMQRAKVLNINLQKQLVEHMMHMKPRKSIYYADF IAANQEKRANNVISGTKFEQLEQIRKDIVEFKTSNKLDQVIILWTANTERFSEIIPGIND TAENLLNAIKKSHSEVSPSTVFAVAAALEGCTYINGSPQNTFVPGAIELAEKHKTFIGGD DFKSGQTKLKSVLVDFLVSAGIKPVSIVSYNHLGNNDGYNLSAPQQFRSKEISKSNVVDD MVQSNKILYQSGEKPDHCVVIKYVPYVGDSKRAMDEYTSEILLGGHNTIVVHNTCEDSLL ASPIILDLVLLAEICSRITFKIADTKDEFTGFHSVLSILSYLCKAPLVPRGTPIVNALFR QRAAIENILRACLALPPENNMLLEHKVNFKNQL |
 Top
| |