| Protein: 94158731 NP_001035299.1 odorant binding protein 19 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 0.9* | 39.2 | 59.9 | 0.015025042 | 0.654424 |
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 3* | 13.4* | 83.7 | 0.035842296 | 0.16009557 |
| Leg, middle | 2.3* | 6* | 91.7 | 0.025081787 | 0.06543075 |
| Leg, rear | 1.1* | 17.3* | 81.6 | 0.013480392 | 0.2120098 |
| Mandibular gland | 9.6 | 90.4 | 0.10619469 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 1.1* | 8.3* | 90.5 | 0.012154696 | 0.091712706 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 3 | 16.8 | 83 | 0.036144577 | 0.20240964 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTIVVIFAFCICVNAMTIEELKIQLRDVQEICKAESGIDQQTVDDINEVNFDVEDEKPQ RYNECILKQFNIVDESGNFKENIVQELTSIYLDENVIKKLVAECSVISDANIYIRFNKLV KCFGKYKTMKEVLNL |
 Top
| |