| Protein: 66524161 XP_624076.1 PREDICTED: ferritin heavy chain |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 9.7* | 90.3 | 0.10741971 | ||
| Scape | 36.1 | 19.1 | 44.8 | 0.8058036 | 0.4263393 |
| Brain | |||||
| Crop | 14* | 86 | 0.1627907 | ||
| Eye | 80.4* | 19.6 | 4.102041 | ||
| Intestine | |||||
| Leg, front | 35.4 | 64.6 | 0.54798764 | ||
| Leg, middle | 44.8 | 55.2 | 0.8115942 | ||
| Leg, rear | 45.2 | 14.9 | 39.9 | 1.132832 | 0.3734336 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 84 | 4.7 | 11.3 | 7.433628 | 0.4159292 |
| Salivary gland, thoracic | 73.9 | 26.1 | 2.8314176 | ||
| Sternite | 15.2 | 34 | 50.8 | 0.2992126 | 0.6692913 |
| Tergite | 4 | 21.7 | 74.3 | 0.0538358 | 0.2920592 |
| Ventriculus | |||||
| Thoracic muscle | 48.9 | 51.1 | 0.95694715 | ||
| Fat body | 5.7 | 8.4* | 85.9 | 0.06635623 | 0.097788125 |
| Malpighian tubules | 52.6 | 1.9* | 45.4 | 1.1585903 | 0.04185022 |
| Nerve chord | 28.4 | 71.6 | 0.39664805 | ||
| Poison sac | 3.9 | 96.1 | 0.040582728 | ||
| Sting | 36.8 | 63.2 | 0.5822785 | ||
| Heart | 12.3 | 23.4 | 64.2 | 0.19158879 | 0.36448598 |
| Hypopharyngeal gland | 35.4 | 64.6 | 0.54798764 | ||
| Galea | 23.1 | 16.5 | 60.4 | 0.38245034 | 0.27317882 |
| Glossa | 15 | 27 | 58 | 0.25862068 | 0.46551725 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 23.5 | 58.3 | 0.5540309 | 0.40308747 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLFLGILFIFLATASAEYCTDEVNKFCSTTKKHEIGIESNCNATYGNIHELLVPLQSYAY GNIEYSFRFLLMSTYLGNYENQREGFKKLYRKYSDEMWENGIDLIKYITKRGGSMNFGQE PKFTPMIKTLELNEFASLATALEIQKSFANQALKIHEKANKKQDSAIAHYMEEKFLEPQA DRVRELAGHIRDMKRFIDESSSHLSIFLFDQYLQQSV |
 Top
| |