| Protein: 328784430 XP_392727.3 PREDICTED: UDP-glucuronosyltransferase 1-10-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.9* | 48.6 | 45.4 | 0.12995595 | 1.0704846 |
| Scape | 36.8 | 15.8 | 47.4 | 0.7763713 | 0.33333334 |
| Brain | |||||
| Crop | 52.7 | 16.1 | 31.2 | 1.6891025 | 0.51602566 |
| Eye | |||||
| Intestine | 26.4 | 40.9 | 32.7 | 0.80733943 | 1.2507645 |
| Leg, front | 19.9* | 20.1* | 60 | 0.33166668 | 0.335 |
| Leg, middle | 26.1 | 13.1* | 60.8 | 0.42927632 | 0.21546052 |
| Leg, rear | 30.8 | 10.5* | 58.7 | 0.5247019 | 0.17887564 |
| Mandibular gland | |||||
| Rectum | 28.5 | 47.4 | 24.1 | 1.1825726 | 1.966805 |
| Salivary gland, cerebral | 4.3* | 40.4 | 55.3 | 0.07775769 | 0.7305606 |
| Salivary gland, thoracic | 40.1 | 26.4 | 33.5 | 1.1970149 | 0.7880597 |
| Sternite | 13.9 | 20.5 | 65.6 | 0.21189025 | 0.3125 |
| Tergite | 11.7 | 3.2* | 85.1 | 0.13748531 | 0.03760282 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 20.9 | 6.5* | 72.6 | 0.28787878 | 0.08953168 |
| Malpighian tubules | 57.1 | 1.3* | 41.6 | 1.3725961 | 0.03125 |
| Nerve chord | 19.1 | 50.8 | 30.2 | 0.63245034 | 1.6821193 |
| Poison sac | |||||
| Sting | |||||
| Heart | 8.9 | 22.2 | 68.9 | 0.12917271 | 0.3222061 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.2 | 24 | 50.8 | 0.496063 | 0.47244096 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRLLLSICLAILACGWCDGLRILALFPITGKSHWIMEERLMIKLAERGHHVDIYTHFPMK NPPKNYNQYSLEGSLEIAVNSITADNVTHFGNVNLEKMSYIAGDRLCDLMKHPHIQKLIK NPPKEPYDLIATELFMSPCYLAFGTYLKVPVIGMITSSFIDWFSHRAGNPINLAITPGLL TSFTERMTFWERLQNTFITNMIMLQTDYYVNKQNSYVKRYMDLDVEIPELYKNLALILVN SHHSVTGVTTKHTGIIEVGGLHLKEDGDPLTPEMQKWLDESTHGCVYFTFGSMVRIETFP KSLVETFYKVFKRIAPVRVMMKVAKKEDLLPGLPNNVMIQPWYPQVSVLKHKNLKAFITH GGLMGTQEAIYFGIPLIGIPLFGDQNLNLQNVARKNVAVNLGSFKNVTEENLYNAIKSVL YDEKYKSNMQKLSELFKDRPMTALDTAVYWVEYVARHGYILQSSAVHLNVFQQNLLDVYG FMLLCVVTVLYLVILLIRKAKNFVFGHKSCLFKKNQSKQEESKKTN |
 Top
| |