Home List proteins by tissue Protein search Downloads Links
Protein: 66514614 XP_396769.2 PREDICTED: chitinase-like protein Idgf4-like
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 12.7 66* 21.3 0.59624416 3.0985916
Scape 29.3 56.4* 14.2 2.0633802 3.971831
Brain 82.7* 17.3 4.780347
Crop 15.4 76.3* 8.3 1.8554217 9.192771
Eye 18.1 63 18.9 0.95767194 3.3333333
Intestine 19.9 63.3* 16.8 1.1845238 3.767857
Leg, front 17.9 61.4 20.7 0.8647343 2.9661837
Leg, middle 18 57.7 24.2 0.74380165 2.3842976
Leg, rear 20.1 56.5 23.4 0.85897434 2.4145298
Mandibular gland 14.4 52.2 33.4 0.4311377 1.5628742
Rectum 22.1 45.7 32.2 0.6863354 1.4192547
Salivary gland, cerebral 17.9 73.6* 8.5 2.1058824 8.658824
Salivary gland, thoracic 10.7* 53.4 35.8 0.2988827 1.4916201
Sternite 24 56.8 19.2 1.25 2.9583333
Tergite 26.8 35.8 37.4 0.71657753 0.95721924
Ventriculus
Thoracic muscle 13.2* 84.4* 2.4 5.5 35.166668
Fat body 40.9 25.7 33.4 1.2245508 0.7694611
Malpighian tubules 36.5 32.8 30.7 1.188925 1.068404
Nerve chord 15.9 41.6 42.5 0.37411764 0.97882354
Poison sac 41.1 58.9 0.6977929
Sting 68.7 31.3 2.194888
Heart 23.7 45.9 30.4 0.77960527 1.5098684
Hypopharyngeal gland 83.2 16.8 4.952381
Galea 34.4 40.1 25.5 1.3490196 1.572549
Glossa 29.1 34.2 36.7 0.7929155 0.9318801
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 21.9 56 25.6 0.85546875 2.1875
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MVTKMKVLIFAAVAVFCVQSVFTVDTHEHNKVVCYWNTTAFERQGPGKFQLDDVQSALSL
CTHLIYGFAGINAETFEVVPLKPSLDTGVGYSYYKLVTQLKRTFPNLKIYLGIGGNADPD
DETHKYLVLTETSQSRSKFINSVNRLLNDYDFDGIDLAWQFPPAKVKKERGTFGSIWHGI
KKTFGYGKFKDDKEVEHRDGFTILVRDLKAQLRPRLKDLTIGVLPHVNSTVYYDARLLAP
NIDAVHLFTFDQKTPERNPREGDYPAPIYESYGRVPQDNVDSTARYWLEHGTPGSKIVVG
IPTYARTWKLTSESQISGVPPIVTDGPGAEGPHTNTPGLLSYAEVCSRLTESAVGRLRRV
GDPSKKYGSYAYQPYNENTGADGIWVGYEDPDTAGNKAAYAKAKGLGGVAIYDLSLDDFR
GVCTGDKYPIIRAAKYKL

Top