| Protein: 66505356 XP_623649.1 PREDICTED: mitochondrial fission 1 protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 16.9* | 83.1 | 0.20336944 | ||
| Scape | 36 | 26.5 | 37.5 | 0.96 | 0.70666665 |
| Brain | |||||
| Crop | 52.1 | 47.9 | 1.0876827 | ||
| Eye | |||||
| Intestine | 46.8 | 53.2 | 0.87969923 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40.3 | 29 | 30.7 | 1.3127036 | 0.9446254 |
| Sternite | 30.9 | 22.9 | 46.2 | 0.66883117 | 0.495671 |
| Tergite | 72.5 | 27.5 | 2.6363637 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 34 | 39.6 | 26.5 | 1.2830188 | 1.4943396 |
| Malpighian tubules | 59.5 | 40.5 | 1.4691358 | ||
| Nerve chord | 5.2* | 94.8 | 0.05485232 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 33.5 | 28.9 | 37.6 | 0.8909575 | 0.76861703 |
| Hypopharyngeal gland | |||||
| Galea | 40.4 | 59.6 | 0.67785233 | ||
| Glossa | 35.7 | 29 | 35.3 | 1.0113314 | 0.82152975 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.4 | 38.8 | 47.7 | 0.6792453 | 0.8134172 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEDVLEEVVSSDDLKKFERIYNEQLRSSVITQKAQFEYAWCLVRSKYPADIRKGIMLLED LYCNHSDSEKRDCLYYLAIGNARIKEYTKALAYVRSFLQVEPGNQQVQHLETLIKKKMEK EGLYGMAIAGGVIIGLASILGLSIAMVKRN |
 Top
| |